- SLC22A2/OCT2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-89417
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Single Cell Western
- SLC22A2/OCT2
- PBS (pH 7.2) and 40% Glycerol
- 0.1 ml (also 25ul)
- OCT2
- Human, Rat
- Unconjugated
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: ESPRWLISQN KNAEAMRIIK HIAKKNGKSL PASLQRLRLE EETGKKLNPS FLDLVRTPQI R
- solute carrier family 22 member 2
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- 63 kDa
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR
Specifications/Features
Available conjugates: Unconjugated